PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0925s0070.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family MYB
Protein Properties Length: 329aa    MW: 36615.9 Da    PI: 5.6973
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0925s0070.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.52e-151966148
                            TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
         Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                            +g W++eEd++l +++   G g+W+ +ar  g+ R++k+c++rw +yl
  SapurV1A.0925s0070.1.p 19 KGLWSPEEDDKLMNYILNNGQGCWSEVARNAGLQRCGKSCRLRWINYL 66
                            678*******************************************97 PP

2Myb_DNA-binding44.73e-1472115146
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
         Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                             rg+++++E+e  ++++ +lG++ W+ Ia++++ gRt++++k++w++
  SapurV1A.0925s0070.1.p  72 RGAFSPQEEEMTIHLHSLLGNR-WSQIAARLP-GRTDNEIKNFWNS 115
                             89********************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.7E-231369IPR009057Homeodomain-like
PROSITE profilePS5129416.2271466IPR017930Myb domain
SuperFamilySSF466891.21E-2717113IPR009057Homeodomain-like
SMARTSM007173.1E-111868IPR001005SANT/Myb domain
PfamPF002494.6E-141966IPR001005SANT/Myb domain
CDDcd001671.34E-92266No hitNo description
PROSITE profilePS5129423.5567121IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.2E-2470122IPR009057Homeodomain-like
SMARTSM007172.5E-1371119IPR001005SANT/Myb domain
PfamPF002495.7E-1372115IPR001005SANT/Myb domain
CDDcd001675.42E-1074114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0050832Biological Processdefense response to fungus
GO:1901348Biological Processpositive regulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 329 aa     Download sequence    Send to blast
MRKPEATGKN NDKSNKFKKG LWSPEEDDKL MNYILNNGQG CWSEVARNAG LQRCGKSCRL  60
RWINYLRPDL KRGAFSPQEE EMTIHLHSLL GNRWSQIAAR LPGRTDNEIK NFWNSTIKRR  120
LKNLQSSNPS PNTSTDSSSE PSKEVIMGAF VSMQEQGINF PMNMDPSPSS LATSMQEMIL  180
NTIMDPLLPT LDRDHGLNMY IGGASGYESN GAPPCMIQGG MNSSDQGLYG LEGIFGGVNV  240
GIPPLASVSY MEENSRSQNI QDNNTDKHPY SSYVNSTLNK NCNSTRTDHN KTENAAAEMG  300
NFWHGEELKV GEWDLEELMK DVSAYPFS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A9e-27191217108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00599PBMTransfer from AT5G12870Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF1486770.0KF148677.1 Populus trichocarpa MYB transcription factor (MYB2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011006199.10.0PREDICTED: transcription factor MYB46-like isoform X1
SwissprotQ9LXV21e-72MYB46_ARATH; Transcription factor MYB46
TrEMBLS5YEC40.0S5YEC4_POPTR; MYB transcription factor
STRINGPOPTR_0009s05860.11e-160(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF77434128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12870.11e-72myb domain protein 46